PIM2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15598
Artikelname: PIM2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15598
Hersteller Artikelnummer: A15598
Alternativnummer: ABB-A15598-100UL,ABB-A15598-20UL,ABB-A15598-500UL,ABB-A15598-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PIM2
This gene encodes a protooncogene that acts as a serine/threonine protein kinase. Studies determined the encoded protein functions to prevent apoptosis and to promote cell survival.
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 11040
UniProt: Q9P1W9
Reinheit: Affinity purification
Sequenz: IRLLDWFETQEGFMLVLERPLPAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKLIDFGSGALLHDEPYTDFDGT
Target-Kategorie: PIM2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Kinase,Cell Biology Developmental Biology,Apoptosis. Shipping: Ice Bag
Western blot analysis of various lysates using PIM2 Rabbit pAb (A15598) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.