PIM2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15598
Article Name: PIM2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15598
Supplier Catalog Number: A15598
Alternative Catalog Number: ABB-A15598-100UL,ABB-A15598-20UL,ABB-A15598-500UL,ABB-A15598-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PIM2
This gene encodes a protooncogene that acts as a serine/threonine protein kinase. Studies determined the encoded protein functions to prevent apoptosis and to promote cell survival.
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 11040
UniProt: Q9P1W9
Purity: Affinity purification
Sequence: IRLLDWFETQEGFMLVLERPLPAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKLIDFGSGALLHDEPYTDFDGT
Target: PIM2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Kinase,Cell Biology Developmental Biology,Apoptosis. Shipping: Ice Bag
Western blot analysis of various lysates using PIM2 Rabbit pAb (A15598) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.