NDUFB11 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15617
- Bilder (1)
| Artikelname: | NDUFB11 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15617 |
| Hersteller Artikelnummer: | A15617 |
| Alternativnummer: | ABB-A15617-100UL,ABB-A15617-20UL,ABB-A15617-1000UL,ABB-A15617-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ESSS, Np15, P17.3, NP17.3, CI-ESSS, MC1DN30, NDUFB11 |
| The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to ubiquinone. Mutations in the human gene are associated with linear skin defects with multiple congenital anomalies 3 and mitochondrial complex I deficiency. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 17kDa |
| NCBI: | 54539 |
| UniProt: | Q9NX14 |
| Reinheit: | Affinity purification |
| Sequenz: | MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRCTGCPRAWDGMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE |
| Target-Kategorie: | NDUFB11 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using NDUFB11 Rabbit pAb (A15617) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Produktgarantie und fachkundiger Support
