NDUFB11 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A15617
- Images (1)
| Article Name: | NDUFB11 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A15617 |
| Supplier Catalog Number: | A15617 |
| Alternative Catalog Number: | ABB-A15617-100UL,ABB-A15617-20UL,ABB-A15617-1000UL,ABB-A15617-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | ESSS, Np15, P17.3, NP17.3, CI-ESSS, MC1DN30, NDUFB11 |
| The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to ubiquinone. Mutations in the human gene are associated with linear skin defects with multiple congenital anomalies 3 and mitochondrial complex I deficiency. |
| Clonality: | Polyclonal |
| Molecular Weight: | 17kDa |
| NCBI: | 54539 |
| UniProt: | Q9NX14 |
| Purity: | Affinity purification |
| Sequence: | MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRCTGCPRAWDGMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE |
| Target: | NDUFB11 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using NDUFB11 Rabbit pAb (A15617) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Product Guarantee and Expert Support
