HSL Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15686
Artikelname: HSL Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15686
Hersteller Artikelnummer: A15686
Alternativnummer: ABB-A15686-100UL,ABB-A15686-20UL,ABB-A15686-500UL,ABB-A15686-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HSL, LHS, REH, AOMS4, FPLD6
The protein encoded by this gene has a long and a short form, generated by use of alternative translational start codons. The long form is expressed in steroidogenic tissues such as testis, where it converts cholesteryl esters to free cholesterol for steroid hormone production. The short form is expressed in adipose tissue, among others, where it hydrolyzes stored triglycerides to free fatty acids.
Klonalität: Polyclonal
Molekulargewicht: 117kDa
NCBI: 3991
UniProt: Q05469
Reinheit: Affinity purification
Sequenz: TLSPSTPSDVNFLLPPEDAGEEAEAKNELSPMDRGLGVRAAFPEGFHPRRSSQGATQMPLYSSPIVKNPFMSPLLAPDSMLKSLPPVHIVACALDPMLDDS
Target-Kategorie: LIPE
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Cholesterol Metabolism,Lipases,AMPK Signaling Pathway,Insulin Receptor Signaling Pathway,Cardiovascular,Lipids. Shipping: Ice Bag
Western blot analysis of lysates from Mouse adipose, using HSL Rabbit pAb (A15686) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.