HSL Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15686
Article Name: HSL Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15686
Supplier Catalog Number: A15686
Alternative Catalog Number: ABB-A15686-100UL,ABB-A15686-20UL,ABB-A15686-500UL,ABB-A15686-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HSL, LHS, REH, AOMS4, FPLD6
The protein encoded by this gene has a long and a short form, generated by use of alternative translational start codons. The long form is expressed in steroidogenic tissues such as testis, where it converts cholesteryl esters to free cholesterol for steroid hormone production. The short form is expressed in adipose tissue, among others, where it hydrolyzes stored triglycerides to free fatty acids.
Clonality: Polyclonal
Molecular Weight: 117kDa
NCBI: 3991
UniProt: Q05469
Purity: Affinity purification
Sequence: TLSPSTPSDVNFLLPPEDAGEEAEAKNELSPMDRGLGVRAAFPEGFHPRRSSQGATQMPLYSSPIVKNPFMSPLLAPDSMLKSLPPVHIVACALDPMLDDS
Target: LIPE
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Cholesterol Metabolism,Lipases,AMPK Signaling Pathway,Insulin Receptor Signaling Pathway,Cardiovascular,Lipids. Shipping: Ice Bag
Western blot analysis of lysates from Mouse adipose, using HSL Rabbit pAb (A15686) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.