FHL5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15756
- Bilder (1)
| Artikelname: | FHL5 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15756 |
| Hersteller Artikelnummer: | A15756 |
| Alternativnummer: | ABB-A15756-20UL,ABB-A15756-100UL,ABB-A15756-1000UL,ABB-A15756-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ACT, FHL-5, dJ393D12.2, 1700027G07Rik, FHL5 |
| The protein encoded by this gene is coordinately expressed with activator of cAMP-responsive element modulator (CREM). It is associated with CREM and confers a powerful transcriptional activation function. CREM acts as a transcription factor essential for the differentiation of spermatids into mature spermatozoa. There are multiple polyadenylation sites found in this gene. Polymorphisms in this gene may be associated with susceptibility for migraine headaches. Alternative splicing results in multiple transcript variants encoding the same protein. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 33kDa |
| NCBI: | 9457 |
| UniProt: | Q5TD97 |
| Reinheit: | Affinity purification |
| Sequenz: | MTTAHFYCQYCTASLLGKKYVLKDDSPYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDRHWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQLWHKECFLCSGCRKDLCEEQFMSRDDYPFCVDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKC |
| Target-Kategorie: | FHL5 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Signal Transduction. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using FHL5 Rabbit pAb (A15756) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Produktgarantie und fachkundiger Support
