FHL5 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A15756
- Images (1)
| Article Name: | FHL5 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A15756 |
| Supplier Catalog Number: | A15756 |
| Alternative Catalog Number: | ABB-A15756-20UL,ABB-A15756-100UL,ABB-A15756-1000UL,ABB-A15756-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | ACT, FHL-5, dJ393D12.2, 1700027G07Rik, FHL5 |
| The protein encoded by this gene is coordinately expressed with activator of cAMP-responsive element modulator (CREM). It is associated with CREM and confers a powerful transcriptional activation function. CREM acts as a transcription factor essential for the differentiation of spermatids into mature spermatozoa. There are multiple polyadenylation sites found in this gene. Polymorphisms in this gene may be associated with susceptibility for migraine headaches. Alternative splicing results in multiple transcript variants encoding the same protein. |
| Clonality: | Polyclonal |
| Molecular Weight: | 33kDa |
| NCBI: | 9457 |
| UniProt: | Q5TD97 |
| Purity: | Affinity purification |
| Sequence: | MTTAHFYCQYCTASLLGKKYVLKDDSPYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDRHWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQLWHKECFLCSGCRKDLCEEQFMSRDDYPFCVDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKC |
| Target: | FHL5 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Signal Transduction. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using FHL5 Rabbit pAb (A15756) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Product Guarantee and Expert Support
