PXR Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A1583
Artikelname: PXR Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A1583
Hersteller Artikelnummer: A1583
Alternativnummer: ABB-A1583-1000UL,ABB-A1583-20UL,ABB-A1583-100UL,ABB-A1583-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: BXR, PAR, PRR, PXR, SAR, SXR, ONR1, PAR1, PAR2, PARq
This gene product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. Several alternatively spliced transcripts encoding different isoforms, some of which use non-AUG (CUG) translation initiation codon, have been described for this gene. Additional transcript variants exist, however, they have not been fully characterized.
Klonalität: Polyclonal
Molekulargewicht: 50 kDa
NCBI: 8856
UniProt: O75469
Reinheit: Affinity purification
Sequenz: CKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKT
Target-Kategorie: NR1I2
Application Verdünnung: WB,1:1500 - 1:6000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Nuclear Receptor Signaling,Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,Drug metabolism. Shipping: Ice Bag
Western blot analysis of lysates from AsPC-1 cells using PXR Rabbit pAb (A1583) at 1:3000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45 s.