PXR Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A1583
Article Name: PXR Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A1583
Supplier Catalog Number: A1583
Alternative Catalog Number: ABB-A1583-1000UL,ABB-A1583-20UL,ABB-A1583-100UL,ABB-A1583-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: BXR, PAR, PRR, PXR, SAR, SXR, ONR1, PAR1, PAR2, PARq
This gene product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. Several alternatively spliced transcripts encoding different isoforms, some of which use non-AUG (CUG) translation initiation codon, have been described for this gene. Additional transcript variants exist, however, they have not been fully characterized.
Clonality: Polyclonal
Molecular Weight: 50 kDa
NCBI: 8856
UniProt: O75469
Purity: Affinity purification
Sequence: CKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKT
Target: NR1I2
Application Dilute: WB,1:1500 - 1:6000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Nuclear Receptor Signaling,Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,Drug metabolism. Shipping: Ice Bag
Western blot analysis of lysates from AsPC-1 cells using PXR Rabbit pAb (A1583) at 1:3000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45 s.