ELP2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15857
- Bilder (1)
| Artikelname: | ELP2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15857 |
| Hersteller Artikelnummer: | A15857 |
| Alternativnummer: | ABB-A15857-20UL,ABB-A15857-100UL,ABB-A15857-500UL,ABB-A15857-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | StIP, MRT58, SHINC-2, STATIP1, ELP2 |
| The protein encoded by this gene is a core subunit of the elongator complex, a histone acetyltransferase complex that associates with RNA polymerase II. In addition to histone acetylation, the encoded protein effects transcriptional elongation and may help remodel chromatin. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 93kDa |
| NCBI: | 55250 |
| UniProt: | Q6IA86 |
| Reinheit: | Affinity purification |
| Sequenz: | QNTVNPREWTPEIVISGHFDGVQDLVWDPEGEFIITVGTDQTTRLFAPWKRKDQSQVTWHEIARPQIHGYDLKCLAMINRFQFVSGADEKVLRVFSAPRNFVENFCAITGQSLNHVLCNQDSDLPEGATVPALGLSNKAVFQGDIASQPSDEEELLTSTGFEYQQVAFQPSILTEPPTEDHLLQNTLWPEVQKLYGHGYEIFCVTCNSSKTLLASACKAAKKEHAAIILWNTTSWKQVQNLVFHSLTVTQMAFSP |
| Target-Kategorie: | ELP2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ELP2 Rabbit pAb (A15857) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Produktgarantie und fachkundiger Support
