ELP2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A15857
- Images (1)
| Article Name: | ELP2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A15857 |
| Supplier Catalog Number: | A15857 |
| Alternative Catalog Number: | ABB-A15857-20UL,ABB-A15857-100UL,ABB-A15857-500UL,ABB-A15857-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | StIP, MRT58, SHINC-2, STATIP1, ELP2 |
| The protein encoded by this gene is a core subunit of the elongator complex, a histone acetyltransferase complex that associates with RNA polymerase II. In addition to histone acetylation, the encoded protein effects transcriptional elongation and may help remodel chromatin. |
| Clonality: | Polyclonal |
| Molecular Weight: | 93kDa |
| NCBI: | 55250 |
| UniProt: | Q6IA86 |
| Purity: | Affinity purification |
| Sequence: | QNTVNPREWTPEIVISGHFDGVQDLVWDPEGEFIITVGTDQTTRLFAPWKRKDQSQVTWHEIARPQIHGYDLKCLAMINRFQFVSGADEKVLRVFSAPRNFVENFCAITGQSLNHVLCNQDSDLPEGATVPALGLSNKAVFQGDIASQPSDEEELLTSTGFEYQQVAFQPSILTEPPTEDHLLQNTLWPEVQKLYGHGYEIFCVTCNSSKTLLASACKAAKKEHAAIILWNTTSWKQVQNLVFHSLTVTQMAFSP |
| Target: | ELP2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ELP2 Rabbit pAb (A15857) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Product Guarantee and Expert Support
