MYOC Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A1589
- Bilder (1)
| Artikelname: | MYOC Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A1589 |
| Hersteller Artikelnummer: | A1589 |
| Alternativnummer: | ABB-A1589-100UL,ABB-A1589-20UL,ABB-A1589-500UL,ABB-A1589-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GPOA, JOAG, TIGR, GLC1A, JOAG1, MYOC |
| MYOC encodes the protein myocilin, which is believed to have a role in cytoskeletal function. MYOC is expressed in many occular tissues, including the trabecular meshwork, and was revealed to be the trabecular meshwork glucocorticoid-inducible response protein (TIGR). The trabecular meshwork is a specialized eye tissue essential in regulating intraocular pressure, and mutations in MYOC have been identified as the cause of hereditary juvenile-onset open-angle glaucoma. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 57kDa |
| NCBI: | 4653 |
| UniProt: | Q99972 |
| Reinheit: | Affinity purification |
| Sequenz: | CGELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPYTQETTWRIDTVGTDVRQVFEYDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELNTETVKAEKEIPGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETNIRKQSVANAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYNPLEKKLFAWDNLNMVTYDI |
| Target-Kategorie: | MYOC |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using MYOC Rabbit pAb (A1589) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Produktgarantie und fachkundiger Support
