MYOC Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A1589
- Images (1)
| Article Name: | MYOC Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A1589 |
| Supplier Catalog Number: | A1589 |
| Alternative Catalog Number: | ABB-A1589-100UL,ABB-A1589-20UL,ABB-A1589-500UL,ABB-A1589-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | GPOA, JOAG, TIGR, GLC1A, JOAG1, MYOC |
| MYOC encodes the protein myocilin, which is believed to have a role in cytoskeletal function. MYOC is expressed in many occular tissues, including the trabecular meshwork, and was revealed to be the trabecular meshwork glucocorticoid-inducible response protein (TIGR). The trabecular meshwork is a specialized eye tissue essential in regulating intraocular pressure, and mutations in MYOC have been identified as the cause of hereditary juvenile-onset open-angle glaucoma. |
| Clonality: | Polyclonal |
| Molecular Weight: | 57kDa |
| NCBI: | 4653 |
| UniProt: | Q99972 |
| Purity: | Affinity purification |
| Sequence: | CGELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPYTQETTWRIDTVGTDVRQVFEYDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELNTETVKAEKEIPGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETNIRKQSVANAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYNPLEKKLFAWDNLNMVTYDI |
| Target: | MYOC |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using MYOC Rabbit pAb (A1589) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Product Guarantee and Expert Support
