CHCHD1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15941
Artikelname: CHCHD1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15941
Hersteller Artikelnummer: A15941
Alternativnummer: ABB-A15941-20UL,ABB-A15941-100UL,ABB-A15941-1000UL,ABB-A15941-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: C2360, MRP-S37, C10orf34, CHCHD1
Enables RNA binding activity. Predicted to be involved in mitochondrial translation. Located in cytosol, mitochondrion, and nuclear lumen.
Klonalität: Polyclonal
Molekulargewicht: 13kDa
NCBI: 118487
UniProt: Q96BP2
Reinheit: Affinity purification
Sequenz: MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQNEFRDDACRKEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYLS
Target-Kategorie: CHCHD1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using CHCHD1 Rabbit pAb (A15941) at 1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.