CHCHD1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15941
Article Name: CHCHD1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15941
Supplier Catalog Number: A15941
Alternative Catalog Number: ABB-A15941-20UL,ABB-A15941-100UL,ABB-A15941-1000UL,ABB-A15941-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: C2360, MRP-S37, C10orf34, CHCHD1
Enables RNA binding activity. Predicted to be involved in mitochondrial translation. Located in cytosol, mitochondrion, and nuclear lumen.
Clonality: Polyclonal
Molecular Weight: 13kDa
NCBI: 118487
UniProt: Q96BP2
Purity: Affinity purification
Sequence: MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQNEFRDDACRKEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYLS
Target: CHCHD1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using CHCHD1 Rabbit pAb (A15941) at 1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.