TPRG1L Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15949
Artikelname: TPRG1L Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15949
Hersteller Artikelnummer: A15949
Alternativnummer: ABB-A15949-100UL,ABB-A15949-20UL,ABB-A15949-500UL,ABB-A15949-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: TPRGL, mover, FAM79A, SVAP30, h-mover, TPRG1L
Predicted to enable identical protein binding activity. Predicted to be involved in regulation of glutamatergic synaptic transmission. Located in extracellular exosome.
Klonalität: Polyclonal
Molekulargewicht: 30kDa
NCBI: 127262
UniProt: Q5T0D9
Reinheit: Affinity purification
Sequenz: MLQLRDSVDSAGTSPTAVLAAGEEVGAGGGPGGGRPGAGTPLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEI
Target-Kategorie: TPRG1L
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using TPRG1L Rabbit pAb (A15949) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.