TPRG1L Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15949
Article Name: TPRG1L Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15949
Supplier Catalog Number: A15949
Alternative Catalog Number: ABB-A15949-100UL,ABB-A15949-20UL,ABB-A15949-500UL,ABB-A15949-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: TPRGL, mover, FAM79A, SVAP30, h-mover, TPRG1L
Predicted to enable identical protein binding activity. Predicted to be involved in regulation of glutamatergic synaptic transmission. Located in extracellular exosome.
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 127262
UniProt: Q5T0D9
Purity: Affinity purification
Sequence: MLQLRDSVDSAGTSPTAVLAAGEEVGAGGGPGGGRPGAGTPLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEI
Target: TPRG1L
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using TPRG1L Rabbit pAb (A15949) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.