RBP4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A1600
Artikelname: RBP4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A1600
Hersteller Artikelnummer: A1600
Alternativnummer: ABB-A1600-20UL,ABB-A1600-100UL,ABB-A1600-1000UL,ABB-A1600-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: RDCCAS, MCOPCB10, RBP4
This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells.
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 5950
UniProt: P02753
Reinheit: Affinity purification
Sequenz: ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Target-Kategorie: RBP4
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Endocrine and metabolic diseases,Diabetes,Cardiovascular,Blood,Serum Proteins,Heart,Cardiovascular diseases,Heart disease. Shipping: Ice Bag
Western blot analysis of various lysates, using RBP4 Rabbit pAb (A1600) at 1:300 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC) :HAP1
Exposure time: 30s.