RBP4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A1600
- Bilder (1)
| Artikelname: | RBP4 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A1600 |
| Hersteller Artikelnummer: | A1600 |
| Alternativnummer: | ABB-A1600-20UL,ABB-A1600-100UL,ABB-A1600-1000UL,ABB-A1600-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | RDCCAS, MCOPCB10, RBP4 |
| This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 21kDa |
| NCBI: | 5950 |
| UniProt: | P02753 |
| Reinheit: | Affinity purification |
| Sequenz: | ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL |
| Target-Kategorie: | RBP4 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Endocrine and metabolic diseases,Diabetes,Cardiovascular,Blood,Serum Proteins,Heart,Cardiovascular diseases,Heart disease. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using RBP4 Rabbit pAb (A1600) at 1:300 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Negative control (NC) :HAP1 Exposure time: 30s. |
Produktgarantie und fachkundiger Support
