RBP4 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A1600
- Images (1)
| Article Name: | RBP4 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A1600 |
| Supplier Catalog Number: | A1600 |
| Alternative Catalog Number: | ABB-A1600-20UL,ABB-A1600-100UL,ABB-A1600-1000UL,ABB-A1600-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | RDCCAS, MCOPCB10, RBP4 |
| This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells. |
| Clonality: | Polyclonal |
| Molecular Weight: | 21kDa |
| NCBI: | 5950 |
| UniProt: | P02753 |
| Purity: | Affinity purification |
| Sequence: | ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL |
| Target: | RBP4 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Endocrine and metabolic diseases,Diabetes,Cardiovascular,Blood,Serum Proteins,Heart,Cardiovascular diseases,Heart disease. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using RBP4 Rabbit pAb (A1600) at 1:300 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Negative control (NC) :HAP1 Exposure time: 30s. |
Product Guarantee and Expert Support
