Zip12 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16006
Artikelname: Zip12 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16006
Hersteller Artikelnummer: A16006
Alternativnummer: ABB-A16006-20UL,ABB-A16006-100UL,ABB-A16006-500UL,ABB-A16006-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ZIP12, ZIP-12, LZT-Hs8, bA570F3.1, Zip12
Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A12 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003 [PubMed 12659941]).
Klonalität: Polyclonal
Molekulargewicht: 77kDa
NCBI: 221074
UniProt: Q504Y0
Reinheit: Affinity purification
Sequenz: MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVLSAGDHPPHNHSRSLIKTLLEKTGCPRRRNGMQGDCNLCFEPDALLLIAGG
Target-Kategorie: SLC39A12
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using Zip12 Rabbit pAb (A16006) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.