Zip12 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16006
Article Name: Zip12 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16006
Supplier Catalog Number: A16006
Alternative Catalog Number: ABB-A16006-20UL,ABB-A16006-100UL,ABB-A16006-500UL,ABB-A16006-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ZIP12, ZIP-12, LZT-Hs8, bA570F3.1, Zip12
Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A12 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003 [PubMed 12659941]).
Clonality: Polyclonal
Molecular Weight: 77kDa
NCBI: 221074
UniProt: Q504Y0
Purity: Affinity purification
Sequence: MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVLSAGDHPPHNHSRSLIKTLLEKTGCPRRRNGMQGDCNLCFEPDALLLIAGG
Target: SLC39A12
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using Zip12 Rabbit pAb (A16006) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.