CHRM3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A1602
Artikelname: CHRM3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A1602
Hersteller Artikelnummer: A1602
Alternativnummer: ABB-A1602-100UL,ABB-A1602-20UL,ABB-A1602-1000UL,ABB-A1602-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HM3, PBS, EGBRS, CHRM3
The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 3 controls smooth muscle contraction and its stimulation causes secretion of glandular tissue. Alternative promoter use and alternative splicing results in multiple transcript variants that have different tissue specificities.
Klonalität: Polyclonal
Molekulargewicht: 66kDa
NCBI: 1131
UniProt: P20309
Reinheit: Affinity purification
Sequenz: QVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQI
Target-Kategorie: CHRM3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease. Shipping: Ice Bag
Western blot analysis of lysates from SH-SY5Y cells, using CHRM3 Rabbit pAb (A1602) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.