CHRM3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A1602
Article Name: CHRM3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A1602
Supplier Catalog Number: A1602
Alternative Catalog Number: ABB-A1602-100UL,ABB-A1602-20UL,ABB-A1602-1000UL,ABB-A1602-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HM3, PBS, EGBRS, CHRM3
The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 3 controls smooth muscle contraction and its stimulation causes secretion of glandular tissue. Alternative promoter use and alternative splicing results in multiple transcript variants that have different tissue specificities.
Clonality: Polyclonal
Molecular Weight: 66kDa
NCBI: 1131
UniProt: P20309
Purity: Affinity purification
Sequence: QVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQI
Target: CHRM3
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease. Shipping: Ice Bag
Western blot analysis of lysates from SH-SY5Y cells, using CHRM3 Rabbit pAb (A1602) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.