SLC28A2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16086
Artikelname: SLC28A2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16086
Hersteller Artikelnummer: A16086
Alternativnummer: ABB-A16086-20UL,ABB-A16086-100UL,ABB-A16086-500UL,ABB-A16086-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CNT2, HCNT2, SPNT1, HsT17153, SLC28A2
Enables neurotransmitter transmembrane transporter activity and nucleoside transmembrane transporter activity. Involved in several processes, including nucleoside transport, purine nucleobase transmembrane transport, and pyrimidine-containing compound transmembrane transport. Predicted to be located in membrane. Predicted to be part of brush border membrane, coated vesicle, and vesicle membrane. Predicted to be integral component of plasma membrane.
Klonalität: Polyclonal
Molekulargewicht: 72kDa
NCBI: 9153
UniProt: O43868
Reinheit: Affinity purification
Sequenz: GAFIAFGVDASSLISASVMAAPCALASSKLAYPEVEESKFKSEEGVKLPRGKERNVLEAASNGAVDAIGLATNVAANLIAFLAVLAFINAALSWLGELVDI
Target-Kategorie: SLC28A2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using SLC28A2 Rabbit pAb (A16086) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.