SLC28A2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16086
Article Name: SLC28A2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16086
Supplier Catalog Number: A16086
Alternative Catalog Number: ABB-A16086-20UL,ABB-A16086-100UL,ABB-A16086-500UL,ABB-A16086-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CNT2, HCNT2, SPNT1, HsT17153, SLC28A2
Enables neurotransmitter transmembrane transporter activity and nucleoside transmembrane transporter activity. Involved in several processes, including nucleoside transport, purine nucleobase transmembrane transport, and pyrimidine-containing compound transmembrane transport. Predicted to be located in membrane. Predicted to be part of brush border membrane, coated vesicle, and vesicle membrane. Predicted to be integral component of plasma membrane.
Clonality: Polyclonal
Molecular Weight: 72kDa
NCBI: 9153
UniProt: O43868
Purity: Affinity purification
Sequence: GAFIAFGVDASSLISASVMAAPCALASSKLAYPEVEESKFKSEEGVKLPRGKERNVLEAASNGAVDAIGLATNVAANLIAFLAVLAFINAALSWLGELVDI
Target: SLC28A2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using SLC28A2 Rabbit pAb (A16086) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.