DENND4A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A16095
- Bilder (1)
| Artikelname: | DENND4A Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A16095 |
| Hersteller Artikelnummer: | A16095 |
| Alternativnummer: | ABB-A16095-20UL,ABB-A16095-100UL,ABB-A16095-1000UL,ABB-A16095-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | IRLB, MYCPBP, DENND4A |
| This gene encodes a DENN domain-containing protein that may function as a guanine nucleotide exchange factor that specifically activates ras-related protein Rab-10. This protein also contains a interferon stimulated response element-binding domain and may be involved in regulating the v-myc avian myelocytomatosis viral (MYC) oncogene. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 8. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 209kDa |
| NCBI: | 10260 |
| UniProt: | Q7Z401 |
| Reinheit: | Affinity purification |
| Sequenz: | RPGRYFLKSSPSTENMHFPSSISSQTRQSCISTSASGLDTSALSVQGNFDLNSKSKLQENFCTRSIQIPANRSKTAMSKCPIFPMARSISTSGPLDKEDTGRQKLISTGSLPATLQGATDSLGLEWHLPSPDPVTVPYLSPLVVWKELESL |
| Target-Kategorie: | DENND4A |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using DENND4A Rabbit pAb (A16095) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
