DENND4A Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A16095
- Images (1)
| Article Name: | DENND4A Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A16095 |
| Supplier Catalog Number: | A16095 |
| Alternative Catalog Number: | ABB-A16095-20UL,ABB-A16095-100UL,ABB-A16095-1000UL,ABB-A16095-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | IRLB, MYCPBP, DENND4A |
| This gene encodes a DENN domain-containing protein that may function as a guanine nucleotide exchange factor that specifically activates ras-related protein Rab-10. This protein also contains a interferon stimulated response element-binding domain and may be involved in regulating the v-myc avian myelocytomatosis viral (MYC) oncogene. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 8. |
| Clonality: | Polyclonal |
| Molecular Weight: | 209kDa |
| NCBI: | 10260 |
| UniProt: | Q7Z401 |
| Purity: | Affinity purification |
| Sequence: | RPGRYFLKSSPSTENMHFPSSISSQTRQSCISTSASGLDTSALSVQGNFDLNSKSKLQENFCTRSIQIPANRSKTAMSKCPIFPMARSISTSGPLDKEDTGRQKLISTGSLPATLQGATDSLGLEWHLPSPDPVTVPYLSPLVVWKELESL |
| Target: | DENND4A |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using DENND4A Rabbit pAb (A16095) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Product Guarantee and Expert Support
