COG4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16111
Artikelname: COG4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16111
Hersteller Artikelnummer: A16111
Alternativnummer: ABB-A16111-20UL,ABB-A16111-100UL,ABB-A16111-500UL,ABB-A16111-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: COD1, CDG2J, SWILS, COG4
The protein encoded by this gene is a component of an oligomeric protein complex involved in the structure and function of the Golgi apparatus. Defects in this gene may be a cause of congenital disorder of glycosylation type IIj. Two transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 89kDa
NCBI: 25839
UniProt: Q9H9E3
Reinheit: Affinity purification
Sequenz: LQVECDRQVEKVVDKFIKQRDYHQQFRHVQNNLMRNSTTEKIEPRELDPILTEVTLMNARSELYLRFLKKRISSDFEVGDSMASEEVKQEHQKCLDKLLNN
Target-Kategorie: COG4
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag
Western blot analysis of various lysates using COG4 Rabbit pAb (A16111) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.