COG4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16111
Article Name: COG4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16111
Supplier Catalog Number: A16111
Alternative Catalog Number: ABB-A16111-20UL,ABB-A16111-100UL,ABB-A16111-500UL,ABB-A16111-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: COD1, CDG2J, SWILS, COG4
The protein encoded by this gene is a component of an oligomeric protein complex involved in the structure and function of the Golgi apparatus. Defects in this gene may be a cause of congenital disorder of glycosylation type IIj. Two transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 89kDa
NCBI: 25839
UniProt: Q9H9E3
Purity: Affinity purification
Sequence: LQVECDRQVEKVVDKFIKQRDYHQQFRHVQNNLMRNSTTEKIEPRELDPILTEVTLMNARSELYLRFLKKRISSDFEVGDSMASEEVKQEHQKCLDKLLNN
Target: COG4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag
Western blot analysis of various lysates using COG4 Rabbit pAb (A16111) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.