UNC50 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16114
Artikelname: UNC50 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16114
Hersteller Artikelnummer: A16114
Alternativnummer: ABB-A16114-100UL,ABB-A16114-20UL,ABB-A16114-1000UL,ABB-A16114-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: URP, GMH1, UNCL, HSD23, PDLs22, UNC50
Predicted to enable RNA binding activity. Predicted to be involved in protein localization to cell surface. Predicted to be located in Golgi apparatus and nuclear inner membrane. Predicted to be integral component of Golgi membrane.
Klonalität: Polyclonal
Molekulargewicht: 30kDa
NCBI: 25972
UniProt: Q53HI1
Reinheit: Affinity purification
Sequenz: MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFG
Target-Kategorie: UNC50
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using UNC50 Rabbit pAb (A16114) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.