UNC50 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16114
Article Name: UNC50 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16114
Supplier Catalog Number: A16114
Alternative Catalog Number: ABB-A16114-100UL,ABB-A16114-20UL,ABB-A16114-1000UL,ABB-A16114-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: URP, GMH1, UNCL, HSD23, PDLs22, UNC50
Predicted to enable RNA binding activity. Predicted to be involved in protein localization to cell surface. Predicted to be located in Golgi apparatus and nuclear inner membrane. Predicted to be integral component of Golgi membrane.
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 25972
UniProt: Q53HI1
Purity: Affinity purification
Sequence: MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFG
Target: UNC50
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using UNC50 Rabbit pAb (A16114) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.