TMEM176B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16118
Artikelname: TMEM176B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16118
Hersteller Artikelnummer: A16118
Alternativnummer: ABB-A16118-20UL,ABB-A16118-100UL,ABB-A16118-500UL,ABB-A16118-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: LR8, MS4B2, TMEM176B
Predicted to be involved in negative regulation of dendritic cell differentiation. Predicted to be located in nuclear membrane. Predicted to be integral component of membrane.
Klonalität: Polyclonal
Molekulargewicht: 29kDa
NCBI: 28959
UniProt: Q3YBM2
Reinheit: Affinity purification
Sequenz: NSFIWQTEPFLYIDTVCDRSDPVFPTTGYRWMRRSQENQWQKEECRAYMQMLRKLFTAIRA
Target-Kategorie: TMEM176B
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag
Western blot analysis of various lysates using TMEM176B Rabbit pAb (A16118) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.