TMEM176B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16118
Article Name: TMEM176B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16118
Supplier Catalog Number: A16118
Alternative Catalog Number: ABB-A16118-20UL,ABB-A16118-100UL,ABB-A16118-500UL,ABB-A16118-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: LR8, MS4B2, TMEM176B
Predicted to be involved in negative regulation of dendritic cell differentiation. Predicted to be located in nuclear membrane. Predicted to be integral component of membrane.
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 28959
UniProt: Q3YBM2
Purity: Affinity purification
Sequence: NSFIWQTEPFLYIDTVCDRSDPVFPTTGYRWMRRSQENQWQKEECRAYMQMLRKLFTAIRA
Target: TMEM176B
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag
Western blot analysis of various lysates using TMEM176B Rabbit pAb (A16118) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.