S100A16 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16167
Artikelname: S100A16 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16167
Hersteller Artikelnummer: A16167
Alternativnummer: ABB-A16167-20UL,ABB-A16167-100UL,ABB-A16167-1000UL,ABB-A16167-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: AAG13, S100F, DT1P1A7, S100A16
Enables calcium ion binding activity and protein homodimerization activity. Predicted to act upstream of or within response to calcium ion. Located in several cellular components, including cytosol, extracellular space, and nucleolus.
Klonalität: Polyclonal
Molekulargewicht: 12kDa
NCBI: 140576
UniProt: Q96FQ6
Reinheit: Affinity purification
Sequenz: MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS
Target-Kategorie: S100A16
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag
Western blot analysis of various lysates, using S100A16 Rabbit pAb (A16167) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.