S100A16 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16167
Article Name: S100A16 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16167
Supplier Catalog Number: A16167
Alternative Catalog Number: ABB-A16167-20UL,ABB-A16167-100UL,ABB-A16167-1000UL,ABB-A16167-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: AAG13, S100F, DT1P1A7, S100A16
Enables calcium ion binding activity and protein homodimerization activity. Predicted to act upstream of or within response to calcium ion. Located in several cellular components, including cytosol, extracellular space, and nucleolus.
Clonality: Polyclonal
Molecular Weight: 12kDa
NCBI: 140576
UniProt: Q96FQ6
Purity: Affinity purification
Sequence: MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS
Target: S100A16
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag
Western blot analysis of various lysates, using S100A16 Rabbit pAb (A16167) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.