GPR141 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16184
Artikelname: GPR141 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16184
Hersteller Artikelnummer: A16184
Alternativnummer: ABB-A16184-20UL,ABB-A16184-100UL,ABB-A16184-1000UL,ABB-A16184-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PGR13, GPR141
GPR141 is a member of the rhodopsin family of G protein-coupled receptors (GPRs) (Fredriksson et al., 2003 [PubMed 14623098]).
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 353345
UniProt: Q7Z602
Reinheit: Affinity purification
Sequenz: VTTMAVINLVVVHSVFLLTVPFRLTYLIKKTWMFGLPFCKFVSAMLHIHMYLTFLFYVVILVTRYLIFFKCKDKVEFYRKLHAVAASAGMWTLVIVIVVPL
Target-Kategorie: GPR141
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: G protein signaling,G-Protein-Coupled ReceptorsGPCR. Shipping: Ice Bag
Western blot analysis of various lysates using GPR141 Rabbit pAb (A16184) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.