GPR141 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16184
Article Name: GPR141 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16184
Supplier Catalog Number: A16184
Alternative Catalog Number: ABB-A16184-20UL,ABB-A16184-100UL,ABB-A16184-1000UL,ABB-A16184-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PGR13, GPR141
GPR141 is a member of the rhodopsin family of G protein-coupled receptors (GPRs) (Fredriksson et al., 2003 [PubMed 14623098]).
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 353345
UniProt: Q7Z602
Purity: Affinity purification
Sequence: VTTMAVINLVVVHSVFLLTVPFRLTYLIKKTWMFGLPFCKFVSAMLHIHMYLTFLFYVVILVTRYLIFFKCKDKVEFYRKLHAVAASAGMWTLVIVIVVPL
Target: GPR141
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: G protein signaling,G-Protein-Coupled ReceptorsGPCR. Shipping: Ice Bag
Western blot analysis of various lysates using GPR141 Rabbit pAb (A16184) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.