SLC6A9 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16203
Artikelname: SLC6A9 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16203
Hersteller Artikelnummer: A16203
Alternativnummer: ABB-A16203-20UL,ABB-A16203-100UL,ABB-A16203-500UL,ABB-A16203-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GLYT1, GCENSG, SLC6A9
The amino acid glycine acts as an inhibitory neurotransmitter in the central nervous system. The protein encoded by this gene is one of two transporters that stop glycine signaling by removing it from the synaptic cleft.
Klonalität: Polyclonal
Molekulargewicht: 78kDa
NCBI: 6536
UniProt: P48067
Reinheit: Affinity purification
Sequenz: MSGGDTRAAIARPRMAAAHGPVAPSSPEQVTLLPVQRSFFLPPFSGATPSTSLAESVLKVWHGAYNSGLLPQLMAQHSLAMAQNGAVPSEATKRDQNLKRGNWGNQIEFV
Target-Kategorie: SLC6A9
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates, using SLC6A9 Rabbit pAb (A16203) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.