SLC6A9 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16203
Article Name: SLC6A9 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16203
Supplier Catalog Number: A16203
Alternative Catalog Number: ABB-A16203-20UL,ABB-A16203-100UL,ABB-A16203-500UL,ABB-A16203-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GLYT1, GCENSG, SLC6A9
The amino acid glycine acts as an inhibitory neurotransmitter in the central nervous system. The protein encoded by this gene is one of two transporters that stop glycine signaling by removing it from the synaptic cleft.
Clonality: Polyclonal
Molecular Weight: 78kDa
NCBI: 6536
UniProt: P48067
Purity: Affinity purification
Sequence: MSGGDTRAAIARPRMAAAHGPVAPSSPEQVTLLPVQRSFFLPPFSGATPSTSLAESVLKVWHGAYNSGLLPQLMAQHSLAMAQNGAVPSEATKRDQNLKRGNWGNQIEFV
Target: SLC6A9
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates, using SLC6A9 Rabbit pAb (A16203) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.