FABPI Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A1621
Artikelname: FABPI Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A1621
Hersteller Artikelnummer: A1621
Alternativnummer: ABB-A1621-100UL,ABB-A1621-20UL,ABB-A1621-1000UL,ABB-A1621-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: FABPI, I-FABP
The protein encoded by this gene is an intracellular fatty acid-binding protein that participates in the uptake, intracellular metabolism, and transport of long-chain fatty acids. The encoded protein is also involved in the modulation of cell growth and proliferation. This protein binds saturated long-chain fatty acids with high affinity, and may act as a lipid sensor to maintain energy homeostasis.
Klonalität: Polyclonal
Molekulargewicht: 15kDa
NCBI: 2169
UniProt: P12104
Reinheit: Affinity purification
Sequenz: MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSTFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD
Target-Kategorie: FABP2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Endocrine Metabolism,Lipid Metabolism,Stem Cells,Cardiovascular,Lipids,Fatty Acids. Shipping: Ice Bag
Western blot analysis of various lysates using FABPI Rabbit pAb (A1621) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.