FABPI Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A1621
Article Name: FABPI Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A1621
Supplier Catalog Number: A1621
Alternative Catalog Number: ABB-A1621-100UL,ABB-A1621-20UL,ABB-A1621-1000UL,ABB-A1621-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: FABPI, I-FABP
The protein encoded by this gene is an intracellular fatty acid-binding protein that participates in the uptake, intracellular metabolism, and transport of long-chain fatty acids. The encoded protein is also involved in the modulation of cell growth and proliferation. This protein binds saturated long-chain fatty acids with high affinity, and may act as a lipid sensor to maintain energy homeostasis.
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 2169
UniProt: P12104
Purity: Affinity purification
Sequence: MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSTFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD
Target: FABP2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Endocrine Metabolism,Lipid Metabolism,Stem Cells,Cardiovascular,Lipids,Fatty Acids. Shipping: Ice Bag
Western blot analysis of various lysates using FABPI Rabbit pAb (A1621) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.