IBSP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16220
Artikelname: IBSP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16220
Hersteller Artikelnummer: A16220
Alternativnummer: ABB-A16220-20UL,ABB-A16220-100UL,ABB-A16220-1000UL,ABB-A16220-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: BSP, BNSP, SP-II, BSP-II, IBSP
The protein encoded by this gene is a major structural protein of the bone matrix. It constitutes approximately 12% of the noncollagenous proteins in human bone and is synthesized by skeletal-associated cell types, including hypertrophic chondrocytes, osteoblasts, osteocytes, and osteoclasts. The only extraskeletal site of its synthesis is the trophoblast. This protein binds to calcium and hydroxyapatite via its acidic amino acid clusters, and mediates cell attachment through an RGD sequence that recognizes the vitronectin receptor.
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 3381
UniProt: P21815
Reinheit: Affinity purification
Sequenz: MKTALILLSILGMACAFSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQGSSDSSEENGDDSSEEEEEEEETSNEGENNEESNEDEDS
Target-Kategorie: IBSP
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Bone,Stem Cells,Mesenchymal Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates, using IBSP Rabbit pAb (A16220) at 1:2500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.