PIMREG Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16222
Artikelname: PIMREG Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16222
Hersteller Artikelnummer: A16222
Alternativnummer: ABB-A16222-20UL,ABB-A16222-100UL,ABB-A16222-500UL,ABB-A16222-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CATS, RCS1, FAM64A, PIMREG
Predicted to be involved in cell division. Located in nucleolus and nucleoplasm.
Klonalität: Polyclonal
Molekulargewicht: 27kDa
NCBI: 54478
UniProt: Q9BSJ6
Reinheit: Affinity purification
Sequenz: MASRWQNMGTSVRRRSLQHQEQLEDSKELQPVVSHQETSVGALGSLCRQFQRRLPLRAVNLNLRAGPSWKRLETPEPGQQGLQAAARSAKSALGAVSQRI
Target-Kategorie: PIMREG
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates, using PIMREG Rabbit pAb (A16222) at 1:700 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.