PIMREG Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16222
Article Name: PIMREG Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16222
Supplier Catalog Number: A16222
Alternative Catalog Number: ABB-A16222-20UL,ABB-A16222-100UL,ABB-A16222-500UL,ABB-A16222-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CATS, RCS1, FAM64A, PIMREG
Predicted to be involved in cell division. Located in nucleolus and nucleoplasm.
Clonality: Polyclonal
Molecular Weight: 27kDa
NCBI: 54478
UniProt: Q9BSJ6
Purity: Affinity purification
Sequence: MASRWQNMGTSVRRRSLQHQEQLEDSKELQPVVSHQETSVGALGSLCRQFQRRLPLRAVNLNLRAGPSWKRLETPEPGQQGLQAAARSAKSALGAVSQRI
Target: PIMREG
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates, using PIMREG Rabbit pAb (A16222) at 1:700 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.