WASF3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16274
Artikelname: WASF3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16274
Hersteller Artikelnummer: A16274
Alternativnummer: ABB-A16274-20UL,ABB-A16274-100UL,ABB-A16274-1000UL,ABB-A16274-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SCAR3, WAVE3, Brush-1, WASF3
This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. A pseudogene of this gene have been defined on chromosome 6. Alternative splicing results in multiple transcript variants
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 10810
UniProt: Q9UPY6
Reinheit: Affinity purification
Sequenz: RTRKEEWERRKMGIEFMSDAKKLEQAGSAKEDRVPSGSHASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQAAEHEYRPPSASARHMALNRPQQ
Target-Kategorie: WASF3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments. Shipping: Ice Bag
Western blot analysis of various lysates using WASF3 Rabbit pAb (A16274) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.