WASF3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16274
Article Name: WASF3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16274
Supplier Catalog Number: A16274
Alternative Catalog Number: ABB-A16274-20UL,ABB-A16274-100UL,ABB-A16274-1000UL,ABB-A16274-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SCAR3, WAVE3, Brush-1, WASF3
This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. A pseudogene of this gene have been defined on chromosome 6. Alternative splicing results in multiple transcript variants
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 10810
UniProt: Q9UPY6
Purity: Affinity purification
Sequence: RTRKEEWERRKMGIEFMSDAKKLEQAGSAKEDRVPSGSHASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQAAEHEYRPPSASARHMALNRPQQ
Target: WASF3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments. Shipping: Ice Bag
Western blot analysis of various lysates using WASF3 Rabbit pAb (A16274) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.