L-Myc Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16301
Artikelname: L-Myc Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16301
Hersteller Artikelnummer: A16301
Alternativnummer: ABB-A16301-20UL,ABB-A16301-100UL,ABB-A16301-1000UL,ABB-A16301-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: LMYC, L-Myc, MYCL1, bHLHe38, MYCL
Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to act upstream of or within regulation of inner ear auditory receptor cell differentiation. Located in chromosome and nucleoplasm.
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 4610
UniProt: P12524
Reinheit: Affinity purification
Sequenz: EDEEIVSPPPVESEAAQSCHPKPVSSDTEDVTKRKNHNFLERKRRNDLRSRFLALRDQVPTLASCSKAPKVVILSKALEYLQALVGAEKRMATEKRQLRCRQQQLQKRIAYLTGY
Target-Kategorie: MYCL
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer. Shipping: Ice Bag
Western blot analysis of various lysates using MYCL Rabbit pAb (A16301) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.