L-Myc Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16301
Article Name: L-Myc Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16301
Supplier Catalog Number: A16301
Alternative Catalog Number: ABB-A16301-20UL,ABB-A16301-100UL,ABB-A16301-1000UL,ABB-A16301-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: LMYC, L-Myc, MYCL1, bHLHe38, MYCL
Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to act upstream of or within regulation of inner ear auditory receptor cell differentiation. Located in chromosome and nucleoplasm.
Clonality: Polyclonal
Molecular Weight: 40kDa
NCBI: 4610
UniProt: P12524
Purity: Affinity purification
Sequence: EDEEIVSPPPVESEAAQSCHPKPVSSDTEDVTKRKNHNFLERKRRNDLRSRFLALRDQVPTLASCSKAPKVVILSKALEYLQALVGAEKRMATEKRQLRCRQQQLQKRIAYLTGY
Target: MYCL
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer. Shipping: Ice Bag
Western blot analysis of various lysates using MYCL Rabbit pAb (A16301) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.