MYRF Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16355
Artikelname: MYRF Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16355
Hersteller Artikelnummer: A16355
Alternativnummer: ABB-A16355-100UL,ABB-A16355-20UL,ABB-A16355-500UL,ABB-A16355-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MRF, CUGS, MMERV, Ndt80, 11orf9, pqn-47, C11orf9, MYRF
This gene encodes a transcription factor that is required for central nervous system myelination and may regulate oligodendrocyte differentiation. It is thought to act by increasing the expression of genes that effect myelin production but may also directly promote myelin gene expression. Loss of a similar gene in mouse models results in severe demyelination. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 124kDa
NCBI: 745
UniProt: Q9Y2G1
Reinheit: Affinity purification
Sequenz: MEVVDETEALQRFFEGHDINGALEPSNIDTSILEEYISKEDASDLCFPDISAPASSASYSHGQPAMPGSSGVHHLSPPGGGPSPGRHGPLPPPGYGTPLN
Target-Kategorie: MYRF
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag
Western blot analysis of various lysates using MYRF Rabbit pAb (A16355) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.